Protein Info for GFF434 in Xanthobacter sp. DMC5

Annotation: Phytoene desaturase (lycopene-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02734: phytoene desaturase
  • amino acids 11 to 499 (489 residues), 704.6 bits, E=3.7e-216
• PF13450: NAD_binding_8
  • amino acids 13 to 74 (62 residues), 50.8 bits, E=4.2e-17
• PF01593: Amino_oxidase
  • amino acids 19 to 494 (476 residues), 165.3 bits, E=7.8e-52

Best Hits

Swiss-Prot: 67% identical to CRTI_ESCVU: Phytoene desaturase (lycopene-forming) (crtI) from Escherichia vulneris

KEGG orthology group: K10027, phytoene dehydrogenase [EC: 1.14.99.-] (inferred from 85% identity to xau:Xaut_3577)

MetaCyc: 67% identical to phytoene desaturase (lycopene-forming) (Pantoea ananatis)
RXN-12414 [EC: 1.3.99.31]

Predicted SEED Role

"Phytoene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

MetaCyc Pathways

• neurosporene biosynthesis (2/5 steps found)
• β-carotene biosynthesis (engineered) (4/8 steps found)
• trans-lycopene biosynthesis I (2/6 steps found)
• okenone biosynthesis (1/6 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Benzoate degradation via hydroxylation
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Naphthalene and anthracene degradation
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.- or 1.3.99.31

Protein Sequence (505 amino acids)

>GFF434 Phytoene desaturase (lycopene-forming) (Xanthobacter sp. DMC5)
MLDVTKSPRRAAVIGSGFGGLSLAIRLQAAGIATTIFEQRDKPGGRAYVHEDKGFTFDGG
PTVITDPSCLEDVYEAAGRRLSDYVDLISVSPFYRLLWSDGRQFDYVNEQTALDAQIAAF
NPADVEGYRRFFAYSKAVFEEGYLKLGAVPFLNFSDMMKAGPQLAKLQAWRSVYSMVSSF
IKDEHLREAFSFHSLLVGGNPFSTSSIYALIHALERKWGVFFPRGGTGALVRGMVKLFTD
LGGTIHLSAKVDEIVVEGDRATGVRVGGEMRPFDLVASNADVVHTYAHLMRNSARGKAEG
AKLARKRHSMSLFVIYFGANRTWDHLQHHTVLFGPRYRGLVDEIFKGPRLPDDFSLYLHA
PTVTDKSLAPEGSTAFYVLSPVPHLGKAEIDWEVEGPKYRDRILGHLEQRLLPGLKESLV
TTRILTPFGFRDELSAHLGSAFSVEPILTQSAWFRPHNRDDKIANLYFAGAGTHPGAGVP
GVVGSAKATAGLILEDLGIAARSPA