Protein Info for PS417_02215 in Pseudomonas simiae WCS417

Annotation: dihydrolipoamide acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 5 to 74 (70 residues), 77.8 bits, E=1.3e-25
  • amino acids 121 to 192 (72 residues), 77.5 bits, E=1.6e-25
• TIGR01348: dihydrolipoyllysine-residue acetyltransferase
  • amino acids 97 to 548 (452 residues), 685.4 bits, E=3.3e-210
• PF02817: E3_binding
  • amino acids 246 to 281 (36 residues), 56.4 bits, 8.1e-19
• PF00198: 2-oxoacid_dh
  • amino acids 319 to 548 (230 residues), 268.6 bits, E=1.3e-83

Best Hits

Swiss-Prot: 78% identical to ODP2_PSEAE: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (aceF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 97% identity to pfs:PFLU0459)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See A0A1N7TX82 at UniProt or InterPro

Protein Sequence (548 amino acids)

>PS417_02215 dihydrolipoamide acetyltransferase (Pseudomonas simiae WCS417)
MSELIRVPDIGSGEGEVIELFVKVGDTVEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELEIEGAADAAPAAAPAAAAAPAPAAEKPAAAEAAPAPAAAPAAATVQ
DIHVPDIGSSGKAKIIELLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE
DEVGTGDFILKLKVQGAAPAAAPAPAAAPAAKAEAAPAAAAPAPAAKAEAAPAPAAAAPA
PSGAKVHAGPAVRQLAREFGVELSAVSATGPHGRVLKEDVQVYVKAMMQKAKEAPAAGGA
TGGSGIPPIRTVDFSRFGEIEEVPMTRLMQIGAAGLHASWLNIPHVTQFDQADITDLEAF
RVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNASLAPSGKAIIRKKYVHIGFAVDT
PDGLLVPVIKNVDQKSLLQLAAEAAALAAKARDKKLTPDDMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLL
NDIRTILL