Protein Info for PS417_02215 in Pseudomonas simiae WCS417

Annotation: dihydrolipoamide acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 PF00364: Biotin_lipoyl" amino acids 5 to 74 (70 residues), 77.8 bits, see alignment E=1.6e-25 amino acids 121 to 192 (72 residues), 77.5 bits, see alignment E=1.9e-25 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 97 to 548 (452 residues), 685.4 bits, see alignment E=3.3e-210 PF02817: E3_binding" amino acids 246 to 281 (36 residues), 56.6 bits, see alignment 8.2e-19 PF00198: 2-oxoacid_dh" amino acids 319 to 548 (230 residues), 262.1 bits, see alignment E=1.5e-81

Best Hits

Swiss-Prot: 78% identical to ODP2_PSEAE: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (aceF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 97% identity to pfs:PFLU0459)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TX82 at UniProt or InterPro

Protein Sequence (548 amino acids)

>PS417_02215 dihydrolipoamide acetyltransferase (Pseudomonas simiae WCS417)
MSELIRVPDIGSGEGEVIELFVKVGDTVEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELEIEGAADAAPAAAPAAAAAPAPAAEKPAAAEAAPAPAAAPAAATVQ
DIHVPDIGSSGKAKIIELLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE
DEVGTGDFILKLKVQGAAPAAAPAPAAAPAAKAEAAPAAAAPAPAAKAEAAPAPAAAAPA
PSGAKVHAGPAVRQLAREFGVELSAVSATGPHGRVLKEDVQVYVKAMMQKAKEAPAAGGA
TGGSGIPPIRTVDFSRFGEIEEVPMTRLMQIGAAGLHASWLNIPHVTQFDQADITDLEAF
RVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNASLAPSGKAIIRKKYVHIGFAVDT
PDGLLVPVIKNVDQKSLLQLAAEAAALAAKARDKKLTPDDMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLL
NDIRTILL