Protein Info for GFF4334 in Xanthobacter sp. DMC5

Annotation: Biotin transport ATP-binding protein BioM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 35 to 176 (142 residues), 96.3 bits, see alignment E=2.5e-31 PF13304: AAA_21" amino acids 144 to 205 (62 residues), 31.3 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 51% identical to BIOM_RHOCB: Biotin transport ATP-binding protein BioM (bioM) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 82% identity to xau:Xaut_2003)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF4334 Biotin transport ATP-binding protein BioM (Xanthobacter sp. DMC5)
MSKMPAAADMRPATAPFARLAGVEVTRGARTVFSNLNLTLTERRIGLVGDNGSGKSTLLR
LLNGLILPDVGTVTVEGLDTRRDRRKLPATVGFVFQNVDHQIIFPSVREEIAFGPIQQGA
PKAEANAAADRLLARHGCAGWGDRAVSDLSEGQKQLVCILSALAAGPSVLLLDEPFSSLD
LTTRLTLASRLGALDVTLVMASHDVDLFAGFDRVIWLKGGEVAADGAPDEIVPLYEADAR
ARAEIAVARSSGRALP