Protein Info for GFF4333 in Xanthobacter sp. DMC5

Annotation: Energy-coupling factor transporter transmembrane protein BioN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details PF02361: CbiQ" amino acids 9 to 198 (190 residues), 47.1 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 77% identity to xau:Xaut_2004)

Predicted SEED Role

"Transmembrane component BioN of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>GFF4333 Energy-coupling factor transporter transmembrane protein BioN (Xanthobacter sp. DMC5)
VIAGYLSGRSPLHRLPAGVKLIALAVLSVLIVPLDSPVLLAMALAAVLIVYSSFGRPGLR
RLAQWRSLAPLLVVIFALQVWAASVEVALASVLRIAVMVLLADLVTLSTRLQDMMDALAL
PMRPLKRFGLDPERIALAVALVLRFVPVLLDTWRGREEAWRARSPRRPGLPLIGAFFSGA
LAMSDQVAEALDARGFGAPRRPRAARKPKI