Protein Info for GFF4333 in Sphingobium sp. HT1-2

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details PF12801: Fer4_5" amino acids 92 to 127 (36 residues), 32.5 bits, see alignment 1.3e-11 PF13746: Fer4_18" amino acids 213 to 346 (134 residues), 110.5 bits, see alignment E=1.1e-35 PF11614: FixG_C" amino acids 386 to 509 (124 residues), 82.1 bits, see alignment E=7.2e-27

Best Hits

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>GFF4333 Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation (Sphingobium sp. HT1-2)
MSSPDDLTGSKQQLFEKRQKVFPKAIDGPFRRFKWLVMAVTLTIYYVTPWLRWDRGPYAP
DQAVLVDIANRRFYMFSIEIWPHEFYYVAGLLIMAGIGLFLVTSAVGRAWCGYACPQTVW
TDLFQHVERAIEGDRNAQLRLEKAPWGPSKIAKRVTKHAIWLLIAVATGGAWIFYFADAP
TLARQLWALDAPYQAWFTIGLLTATTYILGGLMREQFCIYGCPWPRIQGAMLDEKSLMVT
YKAWRGEPRTHGIKRAGPAVHQPDGELGAQAQYGLPSLVALASAPENNPRVIGDCIDCNN
CVAVCPTGIDIRNGPQIGCITCGLCIDACDDIMERIGRPKKLIGYSTVADELLAGNGKTP
EPPLKRLFRPRTLIYFLIWGSIGLAMLFALGSRTRLDLSVRMERNPIWVQLSDGTVRNAY
TINVRNMEARPRSVTLSIEGLPDAQIWTDAQARGGAGQAVEIAIGPDQARKTRVYVAAPE
RQQRDFAFVIRANDGQGATDRESTVFEGPESER