Protein Info for GFF4333 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 4 to 366 (363 residues), 656.8 bits, see alignment E=8.6e-202 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 7 to 362 (356 residues), 507.9 bits, see alignment E=1.8e-156 PF00266: Aminotran_5" amino acids 39 to 298 (260 residues), 84.8 bits, see alignment E=6.1e-28

Best Hits

Swiss-Prot: 100% identical to PHNW_SALTY: 2-aminoethylphosphonate--pyruvate transaminase (phnW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 100% identity to stm:STM0431)

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF4333 2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSV
LLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPDV
QAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDI
AALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLYAQWRCMEDNHGKW
RFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPI
ITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIR
TAMYWTK