Protein Info for GFF433 in Xanthobacter sp. DMC5

Annotation: Lycopene beta-cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01789: lycopene cyclase
  • amino acids 2 to 372 (371 residues), 470.7 bits, E=3.4e-145
• PF05834: Lycopene_cycl
  • amino acids 2 to 372 (371 residues), 381.5 bits, E=4.7e-118
• TIGR01790: lycopene cyclase family protein
  • amino acids 2 to 372 (371 residues), 333.8 bits, E=1.6e-103
• PF13450: NAD_binding_8
  • amino acids 6 to 42 (37 residues), 23.7 bits, 4.9e-09

Best Hits

Swiss-Prot: 50% identical to CRTY_ESCVU: Lycopene beta-cyclase (crtY) from Escherichia vulneris

KEGG orthology group: K06443, lycopene beta cyclase [EC: 1.14.-.-] (inferred from 73% identity to xau:Xaut_3576)

MetaCyc: 48% identical to lycopene beta-cyclase (Pantoea ananatis)
RXN-12496 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]

Predicted SEED Role

"Lycopene cyclase" in subsystem Carotenoids

MetaCyc Pathways

• β-carotene biosynthesis (2/2 steps found)
• chlorobactene biosynthesis (1/2 steps found)
• isorenieratene biosynthesis I (actinobacteria) (2/4 steps found)
• β-carotene biosynthesis (engineered) (4/8 steps found)
• okenone biosynthesis (1/6 steps found)
• superpathway of carotenoid biosynthesis in plants (7/22 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Ascorbate and aldarate metabolism
• Benzoxazinone biosynthesis
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of steroids
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Sphingolipid metabolism
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 5.5.1.19

Protein Sequence (385 amino acids)

>GFF433 Lycopene beta-cyclase (Xanthobacter sp. DMC5)
MDIVFVGAGLANCLIAARIAERRSRVRVLLLEAGESVGGNHSWSYHSSDFGRMQHAFLSP
FRAHVWMGHDVHFPAYSRILKGHYGTITSERMSQVMHERLHPSIRLNAKVAHVAADHVVL
AGGERIDAGAVIDGRGPVSSRHLDLGFQKFLGQEVQLTRPHGLHRPFIMDARVEQIDGYR
FVYVLPLDPQTLLIEDTYYSSGAELPIETLRGRIAAYAGTQGWEIDHVVREEEGVLPIAL
GGDIGAFLAEAPQGVARVGLRAALFHPTTGYSLPDALELADLVSELPDISGPAIAAFVRQ
HAARRWESRGFFRLLNRMLFRAAAPDRRYAILERFYRLPEDLIQRFYGDRLTFKDKARIL
TGRPPVSVLKALSCLPETKSATGPR