Protein Info for GFF4327 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: tRNA S(4)U 4-thiouridine synthase (former ThiI) / Rhodanese-like domain required for thiamine synthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00342: tRNA sulfurtransferase ThiI
  • amino acids 4 to 377 (374 residues), 483.7 bits, E=4e-149
• PF02926: THUMP
  • amino acids 28 to 162 (135 residues), 108.8 bits, E=2.6e-35
• PF02568: ThiI
  • amino acids 175 to 369 (195 residues), 271.6 bits, E=3.7e-85
• TIGR04271: thiazole biosynthesis domain
  • amino acids 383 to 482 (100 residues), 134.6 bits, E=1.1e-43

Best Hits

Swiss-Prot: 100% identical to THII_SALTY: tRNA sulfurtransferase (thiI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 99% identity to ses:SARI_02502)

MetaCyc: 96% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

"tRNA S(4)U 4-thiouridine synthase (former ThiI) / Rhodanese-like domain required for thiamine synthesis" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Protein Sequence (482 amino acids)

>GFF4327 tRNA S(4)U 4-thiouridine synthase (former ThiI) / Rhodanese-like domain required for thiamine synthesis (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR
LVIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEGKTFCVRVKRRGKHEFS
SIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV
LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV
AINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN
LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAIKAKI
EAEEENFDFSILDKVVEEANNVDIREIAQQTQQEVVEVETVSGFGPNDVILDIRSVDEQD
DKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFANVKVY
RP