Protein Info for PS417_22145 in Pseudomonas simiae WCS417

Updated annotation (from data): glucose/xylose ABC transporter, periplasmic substrate-binding component
Rationale: Specifically important for utilization of D-glucose 6-phosphate and D-xylose. Glucokinase (PS417_22685) is important for glucose-6-phosphate utilization, which implies that it is hydrolyzed to glucose before uptake. PS417_22145 is 88% identical to GtsA from P. putida, which is well known as a glucose transporter, but is also involved in xylose uptake in strain S12 (PMC3340264).
Original annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details

Best Hits

Swiss-Prot: 46% identical to SP39_RHIME: Probable sugar-binding periplasmic protein (R03301) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU4846)

Predicted SEED Role

"Glucose ABC transport system, periplasmic sugar-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMI3 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PS417_22145 glucose/xylose ABC transporter, periplasmic substrate-binding component (Pseudomonas simiae WCS417)
MNAINRLAVAISIASLFPLSAFAADSKGTVEVVHWWTSGGEKAAVDVLKAQVEKDGFVWK
DGAVAGGGGATAMTVLKSRAVAGNPPGVAQIKGPDIQEWASTGLLDTDVLKDVAKEEKWD
SLLDKKVSDTVKYEGDYVAVPVNIHRVNWLWINPEVFKKAGITKNPTTLQEFYAAGDKLK
AAGFIPLAHGGQPWQDSTVFEAVVLSVMGADGYKKALVDLDNGALTGPEMVKALTELKKV
ATYMDVDGKGQDWNLEAGKVINGKAGMQIMGDWAKSEWTAAKKVAGKDYECVAFPGTDKA
FTYNIDSLAVFKQKDKGTAAGQQDIAKVVLGENFQKVFSINKGSIPVRNDMLNKMDSYGF
DSCAQTAAKDFLADAKTGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPADTAKKL
GAAIKSAK