Protein Info for GFF4321 in Sphingobium sp. HT1-2

Annotation: Phage integrase, site-specific serine recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00239: Resolvase" amino acids 3 to 135 (133 residues), 146.6 bits, see alignment E=2.8e-47

Best Hits

Swiss-Prot: 49% identical to CIN_BPP1: DNA-invertase (cin) from Escherichia phage P1

KEGG orthology group: None (inferred from 54% identity to nwa:Nwat_2408)

MetaCyc: 49% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF4321 Phage integrase, site-specific serine recombinase (Sphingobium sp. HT1-2)
MLIGYARVSTADQDLTPQIEALQRAGCERQFSDKASGARVNRPGLAEAIDYARPGDVIVV
WKLDRLGRTMKGLVDLAAELEGKQIGLRSITDGIDTSGTAGRLVFNILAAMAQMERELVR
ERTNAALDVARRKGRFGGRRSVMTEQRRAAAEKLLKTEMSATEIASAIGVSISTFYRHFP
VR