Protein Info for GFF4317 in Variovorax sp. SCN45

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 6 to 276 (271 residues), 119.6 bits, see alignment E=6.9e-39

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 36% identity to rva:Rvan_2959)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF4317 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MWIDVVVSGLTAGSLYCLVAVGFNILYRPTKVFNFAQGDLVMVGAMASALLMTQWHWPWV
PAFAAAAAAVALLALLEERVAVAPVLRRSASGTGWIITTLAVAMIMTNIVGKVWGADPIV
VPAPAPLSNDMLGLSAVNISSYQAALIVLTIALVAVVELLYASLWGKATLAVAEDRDAAL
LRGIDPVAISRWSFALGGAFAALTGALAAPVLSASTGLGAMLLLKGFAAAAIGGLGSNRG
ALLAGYLIGMAEAASALLLSPGYHNAVMLVLVLAVLLAKPGGLFSSLEARTV