Protein Info for GFF4314 in Xanthobacter sp. DMC5

Annotation: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01749: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  • amino acids 10 to 176 (167 residues), 300.9 bits, E=1.3e-94
• PF07977: FabA
  • amino acids 35 to 165 (131 residues), 167.4 bits, E=6.8e-54

Best Hits

Swiss-Prot: 82% identical to FABA_RHOP2: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K01716, 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC: 4.2.1.60] (inferred from 90% identity to xau:Xaut_0054)

MetaCyc: 69% identical to 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase (Agrobacterium fabrum C58)
Trans-2-decenoyl-[acyl-carrier-protein] isomerase. [EC: 5.3.3.14]; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 5.3.3.14, 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• biotin biosynthesis I (11/15 steps found)
• palmitate biosynthesis III (21/29 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.59

Use Curated BLAST to search for 4.2.1.59 or 4.2.1.60 or 5.3.3.14

Protein Sequence (186 amino acids)

>GFF4314 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (Xanthobacter sp. DMC5)
MATLARMADRQTSFDYEDLLACGRGELFGAGNAQLPLPPMLMFDRITEISETGGEFGKGM
VRAELDVNPDLWFFACHFKGDPVMPGCLGLDAMWQLVGFHLGWLGSSGRGRALGLGELKF
SGQVLPGVKKVVYGIEFKRVMRSKLVLGIADGWLAADGEVIYRAKDLKVGLFQAETAPQP
AGAASA