Protein Info for GFF4310 in Sphingobium sp. HT1-2

Annotation: IncF plasmid conjugative transfer pilus assembly protein TraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 transmembrane" amino acids 396 to 414 (19 residues), see Phobius details PF11130: TraC_F_IV" amino acids 28 to 271 (244 residues), 167.6 bits, see alignment E=8.5e-53 TIGR02746: type-IV secretion system protein TraC" amino acids 33 to 836 (804 residues), 628.3 bits, see alignment E=8.3e-193 PF19357: DUF5934" amino acids 283 to 454 (172 residues), 275.8 bits, see alignment E=2.7e-86 PF12846: AAA_10" amino acids 469 to 731 (263 residues), 44.9 bits, see alignment E=2.1e-15 PF19044: P-loop_TraG" amino acids 469 to 552 (84 residues), 38 bits, see alignment E=2.1e-13 amino acids 617 to 836 (220 residues), 57.4 bits, see alignment E=2.6e-19 PF01935: DUF87" amino acids 471 to 545 (75 residues), 25.1 bits, see alignment E=4.5e-09

Best Hits

KEGG orthology group: K12063, conjugal transfer ATP-binding protein TraC (inferred from 55% identity to npp:PP1Y_AT15249)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (855 amino acids)

>GFF4310 IncF plasmid conjugative transfer pilus assembly protein TraC (Sphingobium sp. HT1-2)
MAAKTGFIARLLGDTRGPDQGTPSHGAPMLSQWLPYRSFDARNDLFYQTDSLAFALELAP
LMGADERTGEILAQMLSESVPPSARVQLLSFQSPRVGALIAQYALPRFKAGGVHRKIAER
RSAFLRHGAWVSMSKDGPFHVRNHRIFLSVSIAASKATPEELIGVRDSIVSTLASIDMPA
TRMKPVDLIALIDDITAPAFDVSDQVSEYSDLDPIADQCVRRDVQTVVHADRLLVSVEPL
RAVTSLSGETQYEEIRPDTFDYRFFSVRNLPNRWAPWDVQKLIGDMFSDKLRPGCPTLTS
LCLCYQDEQAASSKAGYKFMRTSSLADSKSARLLPQLKDQSREWEHVTQELRLGKKLVQA
YYAVGIISPKGMGDANERTVKSMYKAAGWDLLDERFLQIMAFMSCLPMTLGNGLDSDLKR
MKRLRTMLTSTAANMLPIQGEFLGGGLPHLMFIGRRGQPFFWSPFENKAGNHNVAVFGKS
GSGKSVALQELCAAFAGVGAKIIVIDDGRSFEHMSKSLGGNFVEFRLRDGFSLNPFSMID
EALVAQDEDYLIDALAMLKSIVGQMGRHIDKLNDTERGLIDRAVNQVWEAKGRGGSVDDV
VEALRTDGSPQGQDLAIAMFPFSSAGTYGSFFTGEASVDMSNALTVFELSDLSSREELRS
VVLTAIMFMSSQTMRRMDRQIPKALLIDEAWQMLRGGSMADFVETYSRTCRKYGASLITA
TQSLNDYYKSEGSLAALENSDWSVILMQKPDTISDFQKHGRFDMDPYTESLLRSLKRNGA
EYSDIMIKGPDSMAVGRLVLDKYSATLYSSSPQTFADIEHLIEQGCSMDEAIERVAYPEE
YIGKPIGTPLMEAAE