Protein Info for GFF4309 in Xanthobacter sp. DMC5

Annotation: Ferrous-iron efflux pump FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 5 to 8 (4 residues), see Phobius details transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 10 to 286 (277 residues), 233.5 bits, see alignment E=1.6e-73 PF01545: Cation_efflux" amino acids 11 to 203 (193 residues), 144 bits, see alignment E=5.2e-46 PF16916: ZT_dimer" amino acids 207 to 285 (79 residues), 74.9 bits, see alignment E=4e-25

Best Hits

KEGG orthology group: None (inferred from 84% identity to xau:Xaut_0050)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF4309 Ferrous-iron efflux pump FieF (Xanthobacter sp. DMC5)
MSRKVLWIAAASVLVGAIVLGLKTLAWWVTGSVALLSDALESIINVAASAAALFAITVSA
RPADDNHQFGHHKAEYLSAVLEGVLVVVAAITIMREAYYGFLDPHLPDQPFTGMLINGAA
TVINAIWCLVLLRVGKSMRSPALVADGKHVMTDVVTSVGVLIGFVLVPVTGWPVLDPLIA
GLVALNVLWTGWSLMKESVGGLMDAAPPPDVVARIRELVSLHAAGAIEAHDLRTRHAGRI
TFVEFHLVVPGDMTVAAAHDICDRIESAFERDMDDAIITIHVEPEGEAKHRGVVVV