Protein Info for GFF4307 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 23 to 39 (17 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 321 (276 residues), 137.6 bits, see alignment E=2.3e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 53% identity to pol:Bpro_3840)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF4307 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
VRTGVFHENFASEERLWDSPTSRTWMAAFVLSLFTLPLWGSDYVLAMACIVGIHVIAALG
LNLTTGNAGLISLSHGAFIGVGCYTVAWLGKQGVPFYIALPVAGFVAAFLGVIVGLPSLR
VKGLYLAIATLAAHFILSFAFREWDAVTGGVSGTSIPRANLFGFELVGDRRNFYLIFVCA
FAMAVAARNLARTHIGRAFVAVRDRDISAEILGVHLLRTKLTAFAIGAFYAGVAGGLLGY
FYGSITPDYFVLTLSVFYLAAVIVGGLGTVLGSVLGAVFMTFVPEGLRLLASVSSQAFPG
VAGLLLPMGQVVFGLLIIVFLIFEPHGLAAIWARVRRSFHLWPFKT