Protein Info for GFF4303 in Sphingobium sp. HT1-2

Annotation: IncF plasmid conjugative transfer protein TrbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02742: type-F conjugative transfer system pilin assembly protein TrbC" amino acids 113 to 241 (129 residues), 86.6 bits, see alignment E=6.3e-29 PF09673: TrbC_Ftype" amino acids 114 to 225 (112 residues), 113.3 bits, see alignment E=3e-37

Best Hits

KEGG orthology group: K12059, conjugal transfer pilus assembly protein TrbC (inferred from 53% identity to swi:Swit_5378)

Predicted SEED Role

"IncF plasmid conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF4303 IncF plasmid conjugative transfer protein TrbC (Sphingobium sp. HT1-2)
MKKLLLSIAAIASIGTGAAVLGQSVEGLDLDAVRARSAKADADAAALVGEVQRRGEAFRQ
DAQTVQAVAMEKMRTIDKARLPKGPAGVVDFDEMIQTASANLKDNRGTAPQFMVFVSTSM
PPQALKRIIAETSAAGGVVVFRGFPGNSGKAFIAALAKVVDKEQQFASIGIDPRLFRAFD
VSAVPTYVVASSDFTPCDGLTCKTTPPPFDRMEGNVTVRYALETFADANGPGALVARTAL
ANLVRTP