Protein Info for GFF430 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details PF04290: DctQ" amino acids 43 to 172 (130 residues), 99.7 bits, see alignment E=6.2e-33

Best Hits

KEGG orthology group: None (inferred from 71% identity to azc:AZC_2417)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF430 hypothetical protein (Xanthobacter sp. DMC5)
MAQEVHTRVTGEELAHTFEQQEEVDLSGYAFEDWITLAIFWIMAGLVFTQFFTRYVLNDS
FSWTEELATYCLVAVVFIGAAMCVRLSRHIQVDLIYRFLPERAGHVLSLFVDLVRTSFIA
YGVWLMVRYIALVGDEPMVMVDAPKSVVYYAVLFGFVMMLIRSVQVAIGNIRRGYSVLER
PEAFEGTYDHKGD