Protein Info for GFF43 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF13439: Glyco_transf_4" amino acids 16 to 207 (192 residues), 44.4 bits, see alignment E=3.7e-15 PF13579: Glyco_trans_4_4" amino acids 16 to 202 (187 residues), 87.5 bits, see alignment E=2.5e-28 PF00534: Glycos_transf_1" amino acids 218 to 382 (165 residues), 47.9 bits, see alignment E=2.4e-16 PF13692: Glyco_trans_1_4" amino acids 228 to 368 (141 residues), 53.5 bits, see alignment E=6.6e-18

Best Hits

KEGG orthology group: K03208, colanic acid biosynthesis glycosyl transferase WcaI (inferred from 56% identity to axy:AXYL_04491)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>GFF43 Glycosyl transferase, group 1 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKILIHSANFAPEVIGVGKYSGEMAEWLAAQGHEVRVVAAPPYYPAWQVDRAFHWPPWRH
DTWRGVRVWRAPLWVPRRPGGLQRVLHLCTFALSSLPVMLRQVAWRPDVVLTVAPALVCA
PGGWLTARLSGAQAWLHVQDFEVDVALQMGLLRGERLGRTVRALESWLLRRFDVVSTISG
RMLQHLRRKGVPEERTHLFINWADVARIRPLSGPSPYRAELGLAPGTHVALFSGTLGAKQ
GLMVIPQAARLLAHRSDLVFVVCGNGPMQAELEQAAASLPNLRLLPLQPLERLNDLLGLA
DVHLLPQSREAEDLVLPSKLTGMLASGRPVLATCRTDTELADVVSRCGRVVPPGDAGALA
MALIGLLDHPAQRQALGERAREHALRHLARDAVLQSLVDRMQARRGPAPEGA