Protein Info for GFF4292 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details PF03729: DUF308" amino acids 26 to 94 (69 residues), 41.5 bits, see alignment E=6.4e-15 amino acids 80 to 148 (69 residues), 46.7 bits, see alignment E=1.6e-16 amino acids 143 to 187 (45 residues), 18.5 bits, see alignment 1e-07

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF4292 hypothetical protein (Sphingobium sp. HT1-2)
MASNTAWDQRSEARSGSAWGWILAYAILVILIGFVALANPIATGLTTGVLLGVFLIGYGV
LAIVSGVSSLSDRGRWTEVLLGVLGVVTGGIILFNPFAGAISLVWALGFWLLVSGIFQVA
SAIRGAYDRGWRLALGVLDILLGGYLLFAGPATSLVMLATIVGISFIFRGVFLAFVAFGL
RKLAQPGRANIRN