Protein Info for GFF4291 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details PF13472: Lipase_GDSL_2" amino acids 84 to 229 (146 residues), 54.9 bits, see alignment E=1.7e-18 PF00657: Lipase_GDSL" amino acids 101 to 230 (130 residues), 29.9 bits, see alignment E=6.2e-11

Best Hits

KEGG orthology group: None (inferred from 48% identity to xau:Xaut_2454)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF4291 hypothetical protein (Xanthobacter sp. DMC5)
MSFCPGQQDAGSRPLPARSRFALALAPTLSARQRARLRPWLVALAVAGLAAALVALALHQ
IPLRARIALEADVRARLSNAPVLAIGDSITYQAAPRSLCGEEVLNAAVPGDKIDDLVSRA
GSLESHLQPARVVIAIGANDAVKPKHSIAEWRTLYREIISRFPGSQLVLVEVNPVEHGRS
PYADMLDQSYVAQQNAAIRAIGAETGAVVVPAPQSVSTTDGIHPSRAGALLWRARLFSAA
CR