Protein Info for GFF4286 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF23441: SDR" amino acids 13 to 268 (256 residues), 27.7 bits, see alignment E=3.6e-10 PF00106: adh_short" amino acids 17 to 211 (195 residues), 106.4 bits, see alignment E=2.8e-34 PF08659: KR" amino acids 19 to 108 (90 residues), 37 bits, see alignment E=6.8e-13 PF13561: adh_short_C2" amino acids 26 to 267 (242 residues), 137.8 bits, see alignment E=9.3e-44

Best Hits

KEGG orthology group: None (inferred from 56% identity to rop:ROP_45980)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF4286 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MTTMASGPIRDDALAGKRILITGGGTGLGKELARSFVAHGASVHICGRREGVLQETVAEL
RAHAGQAAQGGTIEHHICDVRSAEQMEAMVDRIWEGGPLTGLVNNAAANFISPSIDISPR
GFEAVRSTVMDGALYATLACGRRWIAQGLPGSVVSMLVTWVWTGSPYVLPSVMAKTAVHA
MTMSLAVEWGRHNIRVNAVAPGPFPTESAWEKLAPIPKANVGAASSEKVPMGRFGKMNEL
CNLLMFLQSDGCDYITGQNIAIDGGHHLAAPSTFAEMNAMTLDDWAEAKRIVRGRAEQEK
AQRSAG