Protein Info for GFF4285 in Xanthobacter sp. DMC5

Annotation: Glutathione-specific gamma-glutamylcyclotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF04752: ChaC" amino acids 52 to 220 (169 residues), 114 bits, see alignment E=4.3e-37

Best Hits

Swiss-Prot: 48% identical to CHAC_ECOLI: Glutathione-specific gamma-glutamylcyclotransferase (chaC) from Escherichia coli (strain K12)

KEGG orthology group: K07232, cation transport protein ChaC (inferred from 67% identity to xau:Xaut_2443)

MetaCyc: 48% identical to glutathione-specific gamma-glutamylcyclotransferase (Escherichia coli K-12 substr. MG1655)
RXN-19024 [EC: 4.3.2.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>GFF4285 Glutathione-specific gamma-glutamylcyclotransferase (Xanthobacter sp. DMC5)
MKMHALTRELIEAGGIDALVARDAPDLAVLTEAERAASLQATLAERPEGPAWLFAYGSLI
WNPTVRVEACRVGRIDGWHRAFCLETVVGRGSPAHPGLTLALDEGGDCTGVAFRLPEEGL
EHELSLLWRREMLSGAYVPRWLDVIDLDGGWIGSAIAFTMDRTSVQYAGGLSEEEVVDRL
ATARGAIGSAADYLFATCEGLAEHGVRDCALDTLAAAVRRRREALDRQG