Protein Info for GFF4280 in Sphingobium sp. HT1-2

Annotation: Uncharacterized UPF0118 membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 12 to 44 (33 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 296 to 324 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 12 to 321 (310 residues), 106 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 68% identity to smk:Sinme_6109)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF4280 Uncharacterized UPF0118 membrane protein (Sphingobium sp. HT1-2)
MTSAKTSQAAQVIIAVILFVVALSIASSVFAPVAFALFIIALVWPLQKALQGALPRLLAP
ALSLFVMVVAFFAFGSLIVWAFGRVGRWIVSDAARFQAFYEQITLWLEGHGIAVAALWSE
NFSSAWVLRAVQTVSGRLNSTMSFWLVVLVYVLLGLLEVEDFGRRLKVMRNRDMAELILR
GSIATAAKIRRYMLVRTAMSVITGLLVWVFARTVGLPLAEEWGFIAFLLNYVPFMGPLVA
TVFPTLFAMTQFGSWQAVIAVFACLNLIQFIVGSYIEPRVAGSALSISPPIVLFSVFFWS
YLWGVFGAFIGVPITIALITFCALHPSSRWLAEMIGAVPKEAGAAGGSGPAA