Protein Info for GFF4275 in Xanthobacter sp. DMC5

Annotation: H(+)/Cl(-) exchange transporter ClcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 396 to 402 (7 residues), see Phobius details PF00654: Voltage_CLC" amino acids 68 to 410 (343 residues), 302.3 bits, see alignment E=2.4e-94

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 78% identity to xau:Xaut_2460)

Predicted SEED Role

"H(+)/Cl(-) exchange transporter ClcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF4275 H(+)/Cl(-) exchange transporter ClcA (Xanthobacter sp. DMC5)
VTSAEPAQKPRDIVYYALAALVGFIGGGVGAGFHWATVKAGEWPLLLREHFQGPALYAAL
SVGAALMVALAVFLVRRFAPEAAGSGVQEIEGALEGLREVRWKRVLPVKFVGGVLALGSG
LVAGREGPTIHMGASIAKAISDAAGLSTRDSRGLLAAGAAAGLAAAFNAPLAAILFVIEE
TRRQFPYGLRTYSAVIICSAASAIVAQVIGGTEPDMQMDVAAVPLHFLPAFIGLGGVLGV
VGIAFNAALVFSLDAARGLALRVSPYILPVVVGAAVGPLLVLRPEATFGGEMLAVSLPGM
GLPALTLAGIVLIRFAMTMASYSTGIPGGIFAPILALATAVGVLFATLLGSLFSLPPQML
AACGIAAMGGLFSATVRAPLVGMVLVAELTGAYDLLLPTILTCVTANLVAEGLGGKPIYE
VLLDRTLRLAGMPRPPEPEQDAIGGWDERERRPQ