Protein Info for GFF4275 in Sphingobium sp. HT1-2

Annotation: Predicted membrane protein (DUF2319)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 36 (14 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details PF15420: Abhydrolase_9_N" amino acids 35 to 242 (208 residues), 221.5 bits, see alignment E=1.3e-69 PF10081: Abhydrolase_9" amino acids 259 to 545 (287 residues), 381.5 bits, see alignment E=2.2e-118

Best Hits

KEGG orthology group: None (inferred from 66% identity to met:M446_0790)

Predicted SEED Role

"FIG00883467: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>GFF4275 Predicted membrane protein (DUF2319) (Sphingobium sp. HT1-2)
MMSFGTRALLLPLRWSRGLSGIGLALGTFLFAASLTPTLVPRTAVIQGVLGGVCFAAGYG
FGTAWRWLWTYLEMPAPNERLRRIVNIVVAGICLLVAGIFLANAAEWQNSIRRVMSMEPI
ESAHPFKVSLIALVTFAVLLTLARLFRLMALFLARRPLGFMPRRVALVAGLAITTVLVWS
LANGFLVRVGFRVLDSSFRERDALIEPASPQPTDPLQSGSQASLVKWRELGRAGREFVAS
RPSAADITALSGRPAMQPIRTYVGLRAAGTAEARARLALEELKRSGAFDRKILVVITPTG
TGWVDPSAISPIEHLGDGDVASVALQYSYLSSPLSLLAQPEYGSEAARALFSEVYGHWTR
LPKERRPRLYLHGLSLGSMNSERSIELLELIGDPIDGAVWSGPPFGNRFWRDITDRRNEG
SPAWLPEYREGRAVRFMNQNGPTVPPATPWGVMRIVYLQYASDAVTFFDRRSFFRKPAWL
EPTRGPDVSPQFRWYPVVTGLQLLVDMAFATRTPMGYGHVYAPQHYVEAWVAVAGAGSWS
PEAQAALKRHLWDHAQRGSDDRDGEEGAYDNRGG