Protein Info for GFF4274 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 transport ATP-binding protein BacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 29 to 308 (280 residues), 208.6 bits, see alignment E=2.5e-65 PF05992: SbmA_BacA" amino acids 36 to 358 (323 residues), 153.7 bits, see alignment E=1.7e-48 PF00005: ABC_tran" amino acids 399 to 530 (132 residues), 82.9 bits, see alignment E=7e-27 PF13191: AAA_16" amino acids 404 to 546 (143 residues), 33.7 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 79% identity to xau:Xaut_2461)

Predicted SEED Role

"ABC transporter-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>GFF4274 Vitamin B12 transport ATP-binding protein BacA (Xanthobacter sp. DMC5)
MLAAKPLPESPALRALLSLLGDIRRLAVPYFKSEERWIAIGLLAAVIALELAWVFATVML
NEWNVAFYNAIQEKDFAAFKTQILIFCAIAAGAIVVAVYQIYLKQWLEVRWRRWLTRRYL
GAWLGDDVHYRLRLGGDEADNPDQRIAEDVQSFINRTISVGVGLLGTVVSLVSFSVILWN
LSGSLPLNLFGRELNVPGYLFWAALIYAAGGTLLAHFIGRPLVKLNFEQQRYEANFRVDL
VRVRENGEQIALLDGARAEERKLEGRFSHIFGNFVELMKAQKRLTWFTAGYNQISTIFPY
VVVAPAYFSGQIQLGQLMQTASAFSSVQGSFSFFISSYVTLAEWTSIVQRLTGFEKAIAA
AQASRPTESLASLPATKALALRGLDVRLPGGAPLIATDELHIAHGECVLITGPSGAGKTT
LLRAIAGIWPYSTGSVHRHAEHRLMVLPQKPYVPAGRLDVALAYPRPVADVPRDQIAEAL
TAVGLSDLAGRLDAEALWPHELSLGEQQRISIARALLEAPEVLLLDEATSAVDEATEAAL
YRLLRERLPESTFISIGHRNTLVDLHDRVLHLHGEEMPRMLGPAAPPALKAV