Protein Info for GFF427 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-xylulose 5-phosphate 3-epimerase (EC 5.1.3.-) homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00542: putative hexulose-6-phosphate isomerase" amino acids 2 to 286 (285 residues), 509.8 bits, see alignment E=9e-158 PF01261: AP_endonuc_2" amino acids 25 to 277 (253 residues), 194.6 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 92% identical to SGBU_ECOLI: Putative L-ribulose-5-phosphate 3-epimerase SgbU (sgbU) from Escherichia coli (strain K12)

KEGG orthology group: K03082, hexulose-6-phosphate isomerase [EC: 5.-.-.-] (inferred from 99% identity to spt:SPA3527)

MetaCyc: 59% identical to L-ribulose-5-phosphate 3-epimerase UlaE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 3-epimerase. [EC: 5.1.3.22]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.1.3.22

Use Curated BLAST to search for 5.-.-.- or 5.1.3.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF427 L-xylulose 5-phosphate 3-epimerase (EC 5.1.3.-) homolog (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLEWTPAQRASLVN
AMLESGVAIPSMCLSAHRRFPFGSRDEAVRQRAREIMTKAIRLARDLGIRTIQLAGYDVY
YEEHDEGTQQRFAEGLAWAVEQAAAAQVMLAVEIMDTAFMNSISKWKKWDEMLSSPWFTV
YPDVGNLSAWGNDVTAELKLGIDRIAAIHLKDTLPVTGDSPGQFRDVPFGEGCVDFVGIF
KTLHELNYRGSFLIEMWTEKASEPVLEIIQARRWIESRMQEGGFTC