Protein Info for GFF4267 in Sphingobium sp. HT1-2

Annotation: IncF plasmid conjugative transfer protein TraD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 834 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details PF10412: TrwB_AAD_bind" amino acids 225 to 614 (390 residues), 497.2 bits, see alignment E=4.6e-153 PF02534: T4SS-DNA_transf" amino acids 430 to 595 (166 residues), 36 bits, see alignment E=5.8e-13 PF12696: TraG-D_C" amino acids 476 to 594 (119 residues), 49.4 bits, see alignment E=6.7e-17

Best Hits

Predicted SEED Role

"IncW plasmid conjugative protein TrwB (TraD homolog)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (834 amino acids)

>GFF4267 IncF plasmid conjugative transfer protein TraD (Sphingobium sp. HT1-2)
MRSNDIRFNGQAATVKHHSARGRITRNSGNFTRGSQLLASQYKMTWAGIQVPIWIWLGTF
IVLFNIFVWLGLAEHEFQLDLMKLYSAVWTWVGADKFHLINLTLPSGIVTKVPIGYVPYE
PHVVHAWAKTVKIFLTTLVMSVFIAAPLIMWFIMWANKRGRDMLQERHNRGAMLVENDVL
LNAVRAHNAKNFRKECAEHDPPFDPARVAKAPVIDRVDQGIHVPYRIAGIPYPWRLEQSH
TMLIGTTGTGKTTQLRSHVSQIRARGHRAVIFDLTGAFVESFYDPETDVILNPMDERCAP
WTLFDECRNYADFVSAAAALIPSHPEDKEPFWQNAARMLFIEMCLKLQEDGEGNNAAIAH
HLMQADLKKIHAKLEDTVAAPLTTEKAARMAESIRSVLNVNGQALRFMPDPVKGGPPAFS
IRDWIATDNRDGSIMFITGSYNDLEMTRGLFTLWIDLAVNNLMRLPKTRDLRTWYLFDEV
HALHALPGIEHGLQSARNFGGAFVLGIHSFDKLVATYGLQNATALTGLARTKLILATADR
TTAEKCSEFIGNREVRQMDEAYSYGYNNTRDASTLTPRTAIEPLVLPDDINNLPSLHGFV
KFPDGFPASRIELKIRSYPEIAPGAVPRKDFKPTEYVSPQDRRRRNESADEGGEGGREHT
PTRPVGGVEEREEEEQQKTQSEAGHARSEAEKAAAAMEVIAAPPVVVDQIQIAQANKAAG
GTEPGQSADGRTASNAETARGTHGQLNLDAKLTGMGMSLIDNRTAAQGAEQTRSNPDMHS
HEGPSNRSDGDRHEDQSTRELRDGFATDRTEDHHHRHHGHDRSPEIDDDMDPEM