Protein Info for GFF4265 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 384 to 407 (24 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 373 (350 residues), 115.2 bits, see alignment E=1.6e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>GFF4265 hypothetical protein (Variovorax sp. SCN45)
MRHIHQPGGIPAALPIAVPLVILAFGHTLSNLLRTLPAMATDVMSLDMGTTAALLGLLTG
VYHLFFALGQLPAGVMLDRLGVRTVSLSLFAMTALGCVAAALAQGPVGFFAAQALLGLGC
CGMLLCPFALAARALPPARFAMWSGLILSIGNCGMLLSATPMAWLIERHGWRASFWLAGA
MAIGIGVLVALAVPRHPRTAPAPARRLKTELREVLALTASLPLRGPVVLAFTSLAAVLAV
RGVWGGPWFMDVKGLTRIEAGNALIPLTLAVAIGPLVAGALDRLTGARRALLAGSHLAAA
GLLLVVVAAAPLGRESAHGVLGSASFDAWVFFVFGCCMSTQPLLFAMGQSATARESAGKA
LAALNLMFFCGTAFHQLASGAIASAFGLAPVFVYFAVFLAVSALLFLRCTRRAPTAACPC