Protein Info for PS417_21840 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR00229: PAS domain S-box protein" amino acids 25 to 141 (117 residues), 56.2 bits, see alignment E=2e-19 amino acids 148 to 260 (113 residues), 50.2 bits, see alignment E=1.4e-17 PF08448: PAS_4" amino acids 31 to 135 (105 residues), 45 bits, see alignment E=3.3e-15 amino acids 153 to 256 (104 residues), 42 bits, see alignment E=2.9e-14 PF00989: PAS" amino acids 32 to 125 (94 residues), 23.5 bits, see alignment E=1.4e-08 amino acids 154 to 253 (100 residues), 24.7 bits, see alignment E=6e-09 PF13426: PAS_9" amino acids 36 to 133 (98 residues), 38.6 bits, see alignment E=3.5e-13 amino acids 158 to 256 (99 residues), 44.2 bits, see alignment E=5.9e-15 PF08447: PAS_3" amino acids 43 to 128 (86 residues), 51.3 bits, see alignment E=3.4e-17 amino acids 164 to 250 (87 residues), 49.7 bits, see alignment E=1.1e-16 PF00015: MCPsignal" amino acids 276 to 431 (156 residues), 134.7 bits, see alignment E=9.4e-43

Best Hits

Swiss-Prot: 55% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 92% identity to pfs:PFLU4783)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMB5 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PS417_21840 chemotaxis protein (Pseudomonas simiae WCS417)
MLFNAHKKTIDSLQHTLAQHASLLDAIERSMAVIEFDLHGNVLRANANFLQAMGYRAEQI
EGQSHRMFCTPAFARSAEYNQLWSNLRNGQYQSGTFERVAGDGQSVWLEASYNPVRDDAG
HVIKVVKYAMDVTPRLQAESEANAKLAAISRAMAVIEFNLDGTIITANANFLQRMGYTLA
QVQGQHHRLFCTKALANSPAYEDFWRRLNQGEMFSGQFERVDKNGQAVWLEANYNPVYDA
GGRLCKVVKFASDVTAMVQQHTADAASAAQAYHISLNTRDIAEKGAEVIQQTASGMRDIA
ADIDGSSQLIAKLGERSQQITAIVNTIRGIADQTNLLALNAAIEAARAGEQGRGFAVVAD
EVRQLAARTSGSTAEISSMIAMIQDETRQAIHSMDGTRDRAAQGVDLANRAGTVILQIRE
GTSDAVQAVSAFANERGGN