Protein Info for GFF4261 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 11 to 533 (523 residues), 827.6 bits, see alignment E=2e-253 PF06506: PrpR_N" amino acids 38 to 202 (165 residues), 176.3 bits, see alignment E=1.1e-55 PF01078: Mg_chelatase" amino acids 219 to 369 (151 residues), 21.8 bits, see alignment E=2.7e-08 PF00158: Sigma54_activat" amino acids 222 to 396 (175 residues), 216.7 bits, see alignment E=4.2e-68 PF14532: Sigma54_activ_2" amino acids 223 to 401 (179 residues), 62.6 bits, see alignment E=1.3e-20 PF02954: HTH_8" amino acids 496 to 533 (38 residues), 47.5 bits, see alignment 3e-16

Best Hits

Swiss-Prot: 100% identical to PRPR_SALTY: Propionate catabolism operon regulatory protein (prpR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 99% identity to sea:SeAg_B0401)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>GFF4261 Propionate catabolism operon regulatory protein PrpR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPIQLGFEKAVTYIRKKL
ATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAGKLTSSIGIVTYQETIP
ALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVVGAGLITDLAEEAGMTAIFIY
SAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYELGDIRGQSPQMEQLRQTITLYAR
SRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPFVAVNCGAITESLLEAELFG
YEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLLRVLEEKAVTRVGGHQPI
PVDVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLPPLRERQADILPLAESFLKQSL
AAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMMERLALFLSVDPAPTLDRQFMRQ
LLPELMVNTAELTPSTVDANALQDVLARFKGDKTAAARYLGISRTTLWRRLKAGAKDQSD
N