Protein Info for GFF4260 in Sphingobium sp. HT1-2

Annotation: Single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF00436: SSB" amino acids 1 to 111 (111 residues), 83.5 bits, see alignment E=5.1e-28 TIGR00621: single-stranded DNA-binding protein" amino acids 1 to 109 (109 residues), 85.1 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: None (inferred from 56% identity to eli:ELI_14670)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>GFF4260 Single-stranded DNA-binding protein (Sphingobium sp. HT1-2)
MNNVNLVGRITRTPELREVNRTTSVATIFVATDRPKLNKDGHTYKGEDGFTVKETEYHKV
TCFNGLAKAIANNRQKGDLIAIEGRLHYTRWQDVDGNDRYGCEIIADRAEFY