Protein Info for PS417_21780 in Pseudomonas simiae WCS417

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 339 to 355 (17 residues), see Phobius details TIGR00838: argininosuccinate lyase" amino acids 8 to 459 (452 residues), 514.8 bits, see alignment E=1.2e-158 PF00206: Lyase_1" amino acids 31 to 305 (275 residues), 192.4 bits, see alignment E=1.3e-60 PF14698: ASL_C2" amino acids 368 to 436 (69 residues), 72.1 bits, see alignment E=4.2e-24

Best Hits

Swiss-Prot: 88% identical to ARLY1_PSEPF: Argininosuccinate lyase 1 (argH1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 88% identity to pfo:Pfl01_2852)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.1

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T908 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PS417_21780 argininosuccinate lyase (Pseudomonas simiae WCS417)
MSQPTDRLWGARFKTGPSAALAALSRCPERYFRLTPYDLAGSRAHARELQRAGLLDESET
LRTLEALDSIGMDFAAGTLHPTLDDEDVHTFIERVLTERLGALGGKLRAGRSRNDQTAND
LRLFLRDHARTITTEVLGLQQALVDQAEQHIESVCPGFTHLQQAQPIVFAHHLLAHAQSM
LRDVQRLVDWDARTALSPLGAAAMAGSAIARQPEHSAKEMGYTGPCENSIDAVASRDHVA
EFLFVAGMLGVNISRLSEEFCLWSSRQFRWVVLDDAYATGSSIMPQKKNPDIAELARGKA
GRLIGNLTGLMSTLKSLPLSYNRDLSEDKHSVLDSVDTLLLVLPAMAGMVATMKVQVEEL
RRQAPMGFTLATEVADWLATRGVPFKEAHEITGALVQACEKHEIELWEASSAMLAEVDAR
LLPEVRDCLSLEAAIAARSGWGGTAPERVREQIGRLKIALAAQQQWAESYQGFRI