Protein Info for GFF4247 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 171 to 208 (38 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF01925: TauE" amino acids 17 to 286 (270 residues), 169.9 bits, see alignment E=4e-54

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 85% identity to xau:Xaut_2487)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF4247 hypothetical protein (Xanthobacter sp. DMC5)
VTIYLPIAELPVAIFTILAMGLAVGFISGMFGVGGGFLMTPLLIFTGVPPAVAVASVSPY
MAASSLSGALSYWRKGLVDTTLAWVLLSGGLVGTISGVLLFLWLRSIGQVDLAIRLSYML
LLGAIGLLMLVESVRAILRARSGAPPSVRRPGTRPAFMRLPLKMRFRRSRIYISALPVIA
IGYVIGLLGAVLGVGGGFILVPALIYLLRVPTQTSVGTSLVLTLVTMAAATVLHAVANGT
VDAVLALVMMIGGTVGAQFGARTGQTLKAENLRLLLGLLVLSVALRVGAELVTAPGDTFA
VTMVETVR