Protein Info for GFF4241 in Xanthobacter sp. DMC5

Annotation: Peptide methionine sulfoxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 46 to 200 (155 residues), 221.1 bits, see alignment E=4.2e-70 PF01625: PMSR" amino acids 47 to 200 (154 residues), 208.8 bits, see alignment E=2.5e-66

Best Hits

Swiss-Prot: 77% identical to MSRA_AZOC5: Peptide methionine sulfoxide reductase MsrA (msrA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 86% identity to xau:Xaut_2494)

MetaCyc: 60% identical to methionine sulfoxide reductase A (Escherichia coli K-12 substr. MG1655)
L-methionine (S)-S-oxide reductase. [EC: 1.8.4.13]; Peptide-methionine (S)-S-oxide reductase. [EC: 1.8.4.13, 1.8.4.11]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF4241 Peptide methionine sulfoxide reductase MsrA (Xanthobacter sp. DMC5)
MFWLKKSLDLPTAAEALPGRATTIPTAEVHYVNGHALKGPYPQGFETAVFALGCFWGAER
KFWQQDGVWATAVGYVAGHTPNPTYEEVCSGKTGHTEAVLVVYDPAVVSYAELLKLFFES
HDPTQGMRQGNDVGTQYRSGIYATSPEQRAEAEAAKAAYGPALKARGFPAITTEIADLGP
FYFAEGYHQQYLAKNPNGYCGLGGTGVSCPIGTGVAAQ