Protein Info for GFF4241 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF00085: Thioredoxin" amino acids 7 to 106 (100 residues), 115.1 bits, see alignment E=2.1e-37 TIGR01068: thioredoxin" amino acids 10 to 108 (99 residues), 129 bits, see alignment E=3.4e-42 PF13098: Thioredoxin_2" amino acids 17 to 107 (91 residues), 38.8 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 68% identical to THIO_PSEAE: Thioredoxin (trxA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 86% identity to ajs:Ajs_2357)

MetaCyc: 66% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>GFF4241 Thioredoxin (Hydrogenophaga sp. GW460-11-11-14-LB1)
MASDLIKHVSDASFQADVLEAGAPVLVDFWAEWCGPCKMIAPILDEVAGSYNGKLKIAKL
NVDDNRDVPAKFGIRGIPTLMLFKDGQLAATKVGAVSKAQLTAFIDQQLA