Protein Info for GFF424 in Variovorax sp. SCN45

Annotation: Cobalamin synthase (EC 2.7.8.26)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 84 (45 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details PF02654: CobS" amino acids 10 to 258 (249 residues), 177.2 bits, see alignment E=2.5e-56

Best Hits

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 87% identity to vpe:Varpa_3355)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF424 Cobalamin synthase (EC 2.7.8.26) (Variovorax sp. SCN45)
MSGIRHFLLALQFFTRVPVTGPLADWVGFSPQMLRASAAHLPGIGWVVGAVAALVFTGVG
MGLPGVAGALAAAVLSTVATVMLTGAFHEDGLADVADGLGGSARRERALEIMKDSRIGAF
GAVALVLALGLKFALLAALAARGLQSVAIAIVGAHVLSRLMPLFLIRWLPYVGDSGASKA
KPLADAISGGALLIAVVWTLPAVALLLLAHDAVHVGAAVLVALLAAGWMARLFMRRLQGF
TGDGLGATQQVCELAIYLALAWHA