Protein Info for GFF4239 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details PF00563: EAL" amino acids 190 to 424 (235 residues), 233.2 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: None (inferred from 48% identity to rpa:RPA3184)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF4239 hypothetical protein (Xanthobacter sp. DMC5)
MAHPSWDDSHTRRVSALTLLESVLLMGIGGLWCVGLLMIDRPLLAGINFAMAALGACLLV
LLRRGRLRLATLLAVHLAPLAVAASCLFDNPPLGVPKATVLYFLPIAAGSYFAFQRDGLY
LRIVLPILYLLAFIAFSLLPLAISDPTLLVPAEAAHVAAWVNTVLALIALVFTLGLMHAD
LTDRRGWEHDLGRAIARGEFRLAYQPQVDRNGHLVGAEALVRWHSPRRGNVPPGQFIPLA
EETGQIVAIGDWVLRAACAQLAKWNAQPGTAHLTLSVNISVAQFLQPDFVRNVTDIVTRS
GCDVSRLKLELTESMLAENMPDMATRMQALCDVGLVWALDDLGAGYSSLQALGQFPFAQI
KLDQSFVRGLPADESSLRIVEAMISLADTLSLMSVAEGVETEEQFRCLVKAGCEAFQGYL
FGRPMDIDSFDALIAPAPDAMARSVDGGSAPHAR