Protein Info for GFF4239 in Variovorax sp. SCN45

Annotation: Mll5186 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 24 to 49 (26 residues), see Phobius details amino acids 63 to 89 (27 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 56% identity to pao:Pat9b_4893)

Predicted SEED Role

"Mll5186 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF4239 Mll5186 protein (Variovorax sp. SCN45)
MTSYGVNTPPTAVLAGDGSRSGVSWGAIFAGAAGAASLSLILLVLGTGLGMSSVSPWAHQ
GASAGAIGLAAILWLSFTQIAASGMGGYLAGRLRTKWAGVHTDEVYFRDTAHGFLAWSVA
TLLTAALLSSVVGSIVGAGAQAGATVASGAATAVGVAGAGAGAAASQSTPDSGAGPMNYF
IDSLFRRDAAAPAAAAGTAPAAGDTGSAQPAMPERGTAATSAEVSRIFLNSIRTGALPPE
DARYVGQVVAQRTGLSQQDAEKRVNDTYAKAQAALKDAQAKAQEAADTARKASAYASLWL
VVSMLIGAFVASFAATHGGRRRDL