Protein Info for PS417_21705 in Pseudomonas simiae WCS417

Annotation: arginine N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF04958: AstA" amino acids 1 to 337 (337 residues), 395.9 bits, see alignment E=5.2e-123 TIGR03245: arginine/ornithine succinyltransferase, alpha subunit" amino acids 3 to 339 (337 residues), 553.8 bits, see alignment E=2e-170 TIGR03243: arginine and ornithine succinyltransferase subunits" amino acids 3 to 338 (336 residues), 445.4 bits, see alignment E=1.1e-137

Best Hits

Swiss-Prot: 84% identical to ASTA_PSEAE: Arginine N-succinyltransferase subunit alpha (astA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00673, arginine N-succinyltransferase [EC: 2.3.1.109] (inferred from 99% identity to pfs:PFLU4756)

MetaCyc: 84% identical to arginine succinyltransferase alpha subunit (Pseudomonas aeruginosa)
Arginine N-succinyltransferase. [EC: 2.3.1.109]; 2.3.1.109 [EC: 2.3.1.109]

Predicted SEED Role

"Arginine N-succinyltransferase, alpha subunit (EC 2.3.1.109)" in subsystem Arginine and Ornithine Degradation (EC 2.3.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.109

Use Curated BLAST to search for 2.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAW9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PS417_21705 arginine N-succinyltransferase (Pseudomonas simiae WCS417)
MLVMRPAQMADLGEVQRLAADSPIGVTSLPDDVERLSDKIAASEASFAAEVSFNGEESYF
FVLEDTETGKLAGCSAIVASAGYSEPFYSFRNETFVHASRELKIHNKIHVLSQCHDLTGN
SLLTSFYVVPELVGSPWSELNSRGRLLFVASHPERFADSVVTEIVGYSDENGDSPFWDAI
GRNFFDLNYAAAERLCGLKSRTFLAELMPHYPIYVPLLPDEAQEAMGQVHPRAQITFDIL
MREGFETDHYIDIFDGGPTLHARVSGIRSIAQSRVVPVKIGEMVKGVGRQYLVSNAQLQD
YRAVMLELDYAPGKPVTLDLAAAEALGVGEGASVRLVAV