Protein Info for GFF4232 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative fimbrial chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00345: PapD_N" amino acids 30 to 154 (125 residues), 149.9 bits, see alignment E=3.6e-48 PF02753: PapD_C" amino acids 180 to 244 (65 residues), 59.3 bits, see alignment E=3.6e-20

Best Hits

Swiss-Prot: 40% identical to YEHC_ECOLI: Probable fimbrial chaperone YehC (yehC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to seg:SG0349)

Predicted SEED Role

"Putative fimbrial chaperone"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF4232 Putative fimbrial chaperone (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKMDTRHSALYYLIVFLFLALPATASWASVTILGSRIIYPSTASSVDVQLKNNDAIPYIV
QTWFDDGDMNTSPENSSAMPLIATPPVFRIQPKAGQVVRVIYNNTKKLPQDRESVFWFNV
LQVPPTNIGSDSGQNKMLVMLRSRIKLFYRPDGLGKPDNLAKKLQIKTVNKGSGKSGIVI
VNPQPWFASLSNLNVKVNGASYNLDADMIAPFSSQTWWLPGKRSLKSFSGTVTVTLVNDL
GARISESYDVPHH