Protein Info for GFF4227 in Sphingobium sp. HT1-2

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF04321: RmlD_sub_bind" amino acids 1 to 168 (168 residues), 43.5 bits, see alignment E=7.9e-15 PF02719: Polysacc_synt_2" amino acids 3 to 113 (111 residues), 39.2 bits, see alignment E=1.7e-13 PF01370: Epimerase" amino acids 3 to 250 (248 residues), 240.1 bits, see alignment E=8.2e-75 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 3 to 335 (333 residues), 480.4 bits, see alignment E=1.2e-148 PF01073: 3Beta_HSD" amino acids 4 to 236 (233 residues), 43.6 bits, see alignment E=6.9e-15 PF16363: GDP_Man_Dehyd" amino acids 4 to 321 (318 residues), 304.6 bits, see alignment E=3.9e-94 PF07993: NAD_binding_4" amino acids 75 to 187 (113 residues), 25.2 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 72% identical to RFBB_SINFN: Probable dTDP-glucose 4,6-dehydratase (NGR_a03580) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 76% identity to avi:Avi_1491)

MetaCyc: 62% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>GFF4227 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Sphingobium sp. HT1-2)
MRVIVTGGAGFIGSALVRYLVLEKGYDVLTIDALTYAGCEASLRHVEGKNNYQFLHANIC
DRAAMDAAITGFKPDRIMHLAAESHVDRSITGAADFIQTNVVGSFTLLEAARAYWNGLEG
AAKATFRFLHVSTDEVYGSLGDEGLFEETTPYAPSSPYSASKAASDHLAKAWQRTYGLPV
VVSNCSNNYGPYHFPEKLIPLTILNALAGRKLSVYGNGENIRDWLYVDDHARALHIIIEK
GEPGETYNVGGRNERKNIDVVLRICAVLDKLVPTDSPRADLIEYVTDRPGHDARYAIDAT
KLENELGWKAQENFDSGIEKTVRWYLANEWWWQPLREQFDGQRLGLDKVDISKAARCPHE
DRRHRHDGAGRH