Protein Info for GFF4226 in Sphingobium sp. HT1-2

Annotation: dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 111 (111 residues), 127.9 bits, E=4.3e-41
• PF01370: Epimerase
  • amino acids 12 to 113 (102 residues), 32.4 bits, E=6.7e-12

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Protein Sequence (141 amino acids)

>GFF4226 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) (Sphingobium sp. HT1-2)
VDKAESESELAHVVNGPGAVVQAAKALGVPLIHISTDYVFDVMLDRPYVEGDPTGPTGVY
GASKLAGEQAVLNGHDNSAVRRLAWFYSPFGGNFVKTMLRLAGNRDELGVVGAIRPARSP
SSRCLTNMLSVIAPNGAVPST