Protein Info for GFF4226 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative hydrolase or acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00561: Abhydrolase_1" amino acids 39 to 269 (231 residues), 107.3 bits, see alignment E=1e-34 PF12697: Abhydrolase_6" amino acids 40 to 293 (254 residues), 64.2 bits, see alignment E=2.9e-21

Best Hits

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 99% identity to see:SNSL254_A0373)

Predicted SEED Role

"Putative hydrolase or acyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF4226 Putative hydrolase or acyltransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHGHPQNHTTWRKVAPTL
AQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVMLMDALGFSRFAFVGHDRGGR
VGHRLALDYPDRVTCCTFIDIAPTATMYALTDKSFATRYFWWFFLIQPFPLPETMIAHDP
AFFLRKHISGQLKIEGATSQEAFNEYLRCYQNPEMIHAICEDYRAAATIDLDDDAADTSA
RIRCPLQLLWGGLGTVGQLYNVVGTWKEKALNVQGEALPCGHSPQEECPEYFIQKLQSFL
HSVL