Protein Info for GFF4224 in Variovorax sp. SCN45
Annotation: Transcriptional regulator, AcrR family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to ACUR_RHOS4: Transcriptional regulator AcuR (acuR) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
KEGG orthology group: None (inferred from 62% identity to bgl:bglu_1g16500)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (210 amino acids)
>GFF4224 Transcriptional regulator, AcrR family (Variovorax sp. SCN45) MTQTKEVSGARARKAQAYASAREVLLRCGMELLTEQGFSATGLEAVLKRATVPKGSFYYY FASKEAFGREVMDAYDAYFGKKLDRWLQDGSRAPLDRLMDFVADASAGMRKHEFRRGCLV GNLSQELGALPEAYRARLDAIFTGWQRKVAACLREAQLSGAVPAGLDCDQLAEFFWIAWE GAVLRARLLRNDQPLRNFIATFLVALGVRA