Protein Info for GFF4216 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcription antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 7 to 112 (106 residues), 103.1 bits, E=9.8e-34
• TIGR00922: transcription termination/antitermination factor NusG
  • amino acids 9 to 180 (172 residues), 236.9 bits, E=6.2e-75
• PF00467: KOW
  • amino acids 130 to 159 (30 residues), 32.4 bits, 5.6e-12

Best Hits

Swiss-Prot: 100% identical to NUSG_SALTY: Transcription termination/antitermination protein NusG (nusG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 99% identity to eco:b3982)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Protein Sequence (181 amino acids)

>GFF4216 Transcription antitermination protein NusG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMVPTEEVVEIRGGQRRKS
ERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGD
KPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEK
A