Protein Info for GFF4215 in Variovorax sp. SCN45

Annotation: L-amino acid ABC transporter (Glu/Asp/His/...), permease protein 1 AapQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 67 to 221 (155 residues), 53.1 bits, see alignment E=1.7e-18

Best Hits

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF4215 L-amino acid ABC transporter (Glu/Asp/His/...), permease protein 1 AapQ (Variovorax sp. SCN45)
MSNRGLLVPAVEGHSVTAIGVGLAIAVGAIFLVALLQRVRFRQTGHARPLWPWAIGLGIA
LPLAGWLLAGQDVRLDLPRASGFSFEGGWSLSPELFALLAGLITYTAAFIAEIVRAGIQA
IGQGQWEAAQSLGLRRGKVLRLVIVPQALRVIVPPLTSQYLNLIKHSSLAVAIGYPDLVS
VVNTTLNQTGQAIEGILIIMGAFMTVSLLISLLMNWYNKRIALVER