Protein Info for GFF4214 in Variovorax sp. SCN45

Annotation: L-amino acid ABC transporter (Glu/Asp/His/...), permease protein 2 AapM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 156 to 251 (96 residues), 69.3 bits, see alignment E=1.7e-23 PF00528: BPD_transp_1" amino acids 173 to 349 (177 residues), 80.4 bits, see alignment E=7.1e-27

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 73% identity to bpe:BP3829)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF4214 L-amino acid ABC transporter (Glu/Asp/His/...), permease protein 2 AapM (Variovorax sp. SCN45)
MSSTPPTAAPQLPFATARMSWRRIRESILHSPASVLGTVLVVWLILMAAPALLNWLLLKA
SFTAPDARTCREASGACWSFIREKYRLILFGTYPFDQQWRPLLATLLLIGSIVVTGVQRL
RGRGLIVWWALALATVAWLMWGGLFGLTFVENVRWGGLPLTLMLSVFGIAFAFPFGVCLA
LGRRSRMPAIKAICVGYIEFIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIAIIMF
AAAYIAEIVRGGLQSIPKGQYEGADSIGLSYWQQMRKVIVPQALKVVIPPLVSTFIALFK
DTSLVVIIGIFDLTQSAKAALADPAWSGFGVEAYLFIGLIYFAFCYCISKYSSTLERSLA
REQQASPGR