Protein Info for GFF4212 in Variovorax sp. SCN45

Annotation: Methionine gamma-lyase (EC 4.4.1.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 242 to 262 (21 residues), see Phobius details PF01053: Cys_Met_Meta_PP" amino acids 14 to 399 (386 residues), 425.3 bits, see alignment E=3.4e-131 PF00155: Aminotran_1_2" amino acids 43 to 282 (240 residues), 53.4 bits, see alignment E=4.8e-18 PF01041: DegT_DnrJ_EryC1" amino acids 67 to 193 (127 residues), 24.2 bits, see alignment E=3.9e-09 PF00266: Aminotran_5" amino acids 89 to 215 (127 residues), 24.8 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 48% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 52% identity to cse:Cseg_0794)

MetaCyc: 48% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF4212 Methionine gamma-lyase (EC 4.4.1.11) (Variovorax sp. SCN45)
MNHTDSSAPLGFQTRSLHHGHDSAAHFGAVSAPIYMTSTFAFDSTADAAAAFSGESDRYV
YGRQHNPTQHLLEQRLASLEGAEAGLVTGSGMGAICSTLLTLLSAGDELIVHHTMYTTAA
SLVNEGLPRFGIKVVQVDLTRPQNLEQALSDKTKIVYFETPVNPTAQLLNIEALAAIAHA
RAGVKVMVDSTFASPALQRPLEHGADLVVHSLTKYINGHGDLLGGAVLGDLQTLQQIRSV
GLKYMTGSTLSPMLCFLVMRGLKTLTLRMRQHSESALKVAQMLRAHRAVKRVRYPFLEDG
DDLTLARAQMSHGGGMLSFELQAGPDDAIRMIDRLKLISRAISLGDTESLITHPGSLLLA
RQKVDPHARLRGGVTMDLVRLSVGLEDADDVIADLQQALDSL