Protein Info for GFF4209 in Xanthobacter sp. DMC5

Annotation: Efflux pump periplasmic linker BepF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 367 (328 residues), 246.3 bits, see alignment E=1.9e-77 PF16576: HlyD_D23" amino acids 51 to 286 (236 residues), 39.7 bits, see alignment E=5.2e-14 PF13533: Biotin_lipoyl_2" amino acids 66 to 112 (47 residues), 35 bits, see alignment 1.5e-12 PF13437: HlyD_3" amino acids 176 to 281 (106 residues), 22.7 bits, see alignment E=2.1e-08

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 80% identity to xau:Xaut_4352)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF4209 Efflux pump periplasmic linker BepF (Xanthobacter sp. DMC5)
MGIIARPKPAHFKSVGPVLWAAALLLCATPAGAQQGPIPVGVAAAELKPIADAMEFVGRV
EAPERVDIRARVKAMLEAVLFKEGEMVKEGQPLYRIEKPPFQADVQQAEGDVERAKAALT
LAKIQRERAEELLTKNAGTVVARDQAVANEESAKGALLTAEAALNTAKINLGYTDIVSPI
AGRIGRTAFTRGHIIGPESGPLATVVSQNPMYVTFPVSQRDYQEAQKDEGKVDLSNVEVR
IKFPDGSIYGEVGRINFIDVSVSRTTDTIIMRADVPNPKGQLVDGQLVRVELKSGKPEER
VVIPQAALIADQAGVYVFVVEDGKAVVRRVKPGGNVGSNIIVDGIKPGEPVIVDGFEALR
PNAPVRATPVLGVKG